PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009592889.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 272aa    MW: 30464.2 Da    PI: 8.5716
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009592889.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-18128182256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tk q   Lee F+++++++ ++++eLA++l+L  rqV vWFqNrRa+ k
  XP_009592889.1 128 RKKLRLTKAQSALLEESFKQHSTLNPKQKQELARNLNLRPRQVEVWFQNRRARTK 182
                     788899***********************************************98 PP

2HD-ZIP_I/II124.26.1e-40128216190
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                     +kk+rl+k q++lLEesF+++++L+p++K+elar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +eL+ +
  XP_009592889.1 128 RKKLRLTKAQSALLEESFKQHSTLNPKQKQELARNLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTEENRRLHKELQELK-A 216
                     69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.68E-19115185IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-18121187IPR009057Homeodomain-like
PROSITE profilePS5007117.702124184IPR001356Homeobox domain
SMARTSM003891.6E-15126188IPR001356Homeobox domain
CDDcd000864.91E-16128185No hitNo description
PfamPF000465.4E-16128182IPR001356Homeobox domain
PROSITE patternPS000270159182IPR017970Homeobox, conserved site
SMARTSM003405.0E-24184227IPR003106Leucine zipper, homeobox-associated
PfamPF021837.4E-11184217IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGSFDDISST GLVLGLGFST TADQKSTKIA PVVLDKGPSL SFEPSLRLSL SGDHTYEKQE  60
AVKKVNNVTR GPNDHQSVDL YRQDSAASSY SNASVKRERD VGSEETTTEV ERLSSRVSDE  120
DDDGSNARKK LRLTKAQSAL LEESFKQHST LNPKQKQELA RNLNLRPRQV EVWFQNRRAR  180
TKLKQTEVDC EFLKKCCETL TEENRRLHKE LQELKAVKIA QPLYMQLPAA TLTMCPSCER  240
IGGVGENPSK NPFTLAQKPY FYNSFTNPSA AC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1176184RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9989710.0EU998971.1 Nicotiana benthamiana homeodomain leucine-zipper 1 (HB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592889.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like
RefseqXP_016496679.10.0PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466045e-92HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLC6FFS41e-173C6FFS4_NICBE; Homeodomain leucine-zipper 1
STRINGPGSC0003DMT4000551991e-149(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-93HD-ZIP family protein